PDB entry 3i78

View 3i78 on RCSB PDB site
Description: 35/99/170/186/220-loops of FXa in SGT
Class: hydrolase
Keywords: BETA SHEETS, SERINE PROTEASE, HYDROLASE, Disulfide bond, Protease, Zymogen
Deposited on 2009-07-08, released 2010-06-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.211
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sprT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00775 (0-228)
      • see remark 999 (18-23)
      • see remark 999 (25)
      • see remark 999 (80-83)
      • see remark 999 (85)
      • see remark 999 (150-154)
      • see remark 999 (160)
      • see remark 999 (168-170)
      • see remark 999 (191)
      • see remark 999 (200)
      • see remark 999 (205)
      • see remark 999 (207-208)
    Domains in SCOPe 2.04: d3i78a_
  • Heterogens: NA, BEN, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i78A (A:)
    vvggtraaqgefpfmvrlineenegfcggalyaqdivltaahcvsgsgnntsitatggvv
    dlqsssavkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftva
    gwganreggsqqryllkanvpfvsdaacrssssfilvanemicagydtkqedtcqgdsgg
    pmfrkdnadewvqvgivswgegcarkgkygvytevstfasaiasaartl