PDB entry 3i77

View 3i77 on RCSB PDB site
Description: 35/99/170-loops of FXa in SGT
Class: hydrolase
Keywords: BETA SHEETS, SERINE PROTEASE, HYDROLASE, Disulfide bond, Protease, Zymogen
Deposited on 2009-07-08, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sprT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00775 (0-229)
      • see remark 999 (18-23)
      • see remark 999 (25)
      • see remark 999 (80-83)
      • see remark 999 (85)
      • see remark 999 (150-154)
      • see remark 999 (160)
    Domains in SCOPe 2.07: d3i77a_
  • Heterogens: CA, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i77A (A:)
vvggtraaqgefpfmvrlineenegfcggalyaqdivltaahcvsgsgnntsitatggvv
dlqsssavkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftva
gwganreggsqqryllkanvpfvsdaacrssssfilvanemicagypdtggvdtcqgdsg
gpmfrkdnadewiqvgivswgygcarpgypgvytevstfasaiasaartl