PDB entry 3i76

View 3i76 on RCSB PDB site
Description: The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, HYDROLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-07-08, released 2009-07-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HAD-hydrolase yfnB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07330, yfnB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i76a_
  • Chain 'B':
    Compound: Putative HAD-hydrolase yfnB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07330, yfnB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i76b_
  • Chain 'C':
    Compound: Putative HAD-hydrolase yfnB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU07330, yfnB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i76c_
  • Heterogens: MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i76A (A:)
    mslkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafee
    gkmtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdl
    yivtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtli
    igdsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnientvseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i76A (A:)
    kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
    trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
    tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
    sltadikggqlagldtcwmnpdmkiiptyeirkleelyhilni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i76B (B:)
    mslkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafee
    gkmtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdl
    yivtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtli
    igdsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnientvseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i76B (B:)
    kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
    trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
    tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
    sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i76C (C:)
    mslkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafee
    gkmtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdl
    yivtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtli
    igdsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnientvseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i76C (C:)
    kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
    trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
    tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
    sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilni