PDB entry 3i75

View 3i75 on RCSB PDB site
Description: Antibody Structure
Class: immune system
Keywords: Antibody, IgG, IMMUNE SYSTEM
Deposited on 2009-07-08, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I75 (0-211)
    Domains in SCOPe 2.07: d3i75a1, d3i75a2
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I75 (0-224)
  • Heterogens: SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i75A (A:)
    diqmtqspsslsaslggkvtitcqssqdinkyigwyqhkpgkgprllihytsilrpdips
    rfsgsgsgrdysfsisnlepedtatyyclqyddllltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnra
    

  • Chain 'B':
    No sequence available.