PDB entry 3i6q

View 3i6q on RCSB PDB site
Description: Structure of the binary complex leucoanthocyanidin reductase-NADPH from vitis vinifera
Class: oxidoreductase
Keywords: Rossmann fold, short chain dehydrogenase reductase, flavonoid, oxidoreductase
Deposited on 2009-07-07, released 2010-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative leucoanthocyanidin reductase 1
    Species: Vitis vinifera [TaxId:29760]
    Gene: LAR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i6qa_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6qA (A:)
    mtvspvpspkgrvliagatgfigqfvatasldahrptyilarpgprspskakifkaledk
    gaiivyglineqeamekilkeheidivvstvggesildqialvkamkavgtikrflpsef
    ghdvnradpvepglnmyrekrrvrqlveesgipftyiccnsiaswpyynnihpsevlppt
    dffqiygdgnvkayfvagtdigkftmktvddvrtlnksvhfrpscnclninelasvwekk
    igrtlprvtvteddllaaageniipqsvvaafthdifikgcqvnfsidgpedvevttlyp
    edsfrtveecfgeyivkmeekqptadsaiantgpvvgmrqvtatca
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6qA (A:)
    grvliagatgfigqfvatasldahrptyilarfkaledkgaiivyglineqeamekilke
    heidivvstvggesildqialvkamkavgtikrflpsefghdvnradpvepglnmyrekr
    rvrqlveesgipftyiccnsiaswpyynnvlpptdffqiygdgnvkayfvagtdigkftm
    ktvddvrtlnksvhfrpscnclninelasvwekkigrtlprvtvteddllaaageniipq
    svvaafthdifikgcqvnfsidgpedvevttlypedsfrtveecfgeyivk