PDB entry 3i6p

View 3i6p on RCSB PDB site
Description: Ethanolamine Utilization Microcompartment Shell Subunit, EutM
Class: structural protein
Keywords: structural protein
Deposited on 2009-07-07, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pa_
  • Chain 'B':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pb_
  • Chain 'C':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pc_
  • Chain 'D':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pd_
  • Chain 'E':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pe_
  • Chain 'F':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6pf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6pA (A:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pA (A:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i6pB (B:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pB (B:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i6pC (C:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pC (C:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i6pD (D:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pD (D:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i6pE (E:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pE (E:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i6pF (F:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6pF (F:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpigl