PDB entry 3i6o
View 3i6o on RCSB PDB site
Description: Crystal structure of wild type HIV-1 protease with macrocyclic inhibitor GRL-0216A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, macrocyclic ligand, AIDS, Aspartyl protease, Hydrolase
Deposited on
2009-07-07, released
2009-09-29
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.161
AEROSPACI score: 0.84
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.04: d3i6oa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.04: d3i6ob_ - Heterogens: NA, IOD, GOL, GR6, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3i6oA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3i6oB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf