PDB entry 3i6o

View 3i6o on RCSB PDB site
Description: Crystal structure of wild type HIV-1 protease with macrocyclic inhibitor GRL-0216A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, macrocyclic ligand, AIDS, Aspartyl protease, Hydrolase
Deposited on 2009-07-07, released 2009-09-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.161
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.04: d3i6oa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.04: d3i6ob_
  • Heterogens: NA, IOD, GOL, GR6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i6oA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i6oB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf