PDB entry 3i6o

View 3i6o on RCSB PDB site
Description: Crystal structure of wild type HIV-1 protease with macrocyclic inhibitor GRL-0216A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, macrocyclic ligand, AIDS, Aspartyl protease, Hydrolase
Deposited on 2009-07-07, released 2009-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.161
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.03: d3i6oa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.03: d3i6ob_
• Heterogens: NA, IOD, GOL, GR6, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i6oA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i6oB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf