PDB entry 3i6m

View 3i6m on RCSB PDB site
Description: 3D Structure of Torpedo californica acetylcholinesterase complexed with N-piperidinopropyl-galanthamine
Class: hydrolase
Keywords: Serine hydrolase, Cholinesterase, Neurotransmitter degradation, Alzheimer's disease, Bis-functional galanthamine derivative, Alternative splicing, Cell junction, Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Hydrolase, Lipoprotein, Membrane, Serine esterase, Synapse
Deposited on 2009-07-07, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i6ma_
  • Heterogens: NAG, G3X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i6mA (A:)
    dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
    typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
    sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
    dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
    rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
    ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
    handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
    ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
    pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat