PDB entry 3i6b

View 3i6b on RCSB PDB site
Description: Crystal structure of YrbI lacking the last 8 residues, in complex with Kdo and inorganic phosphate
Class: hydrolase
Keywords: YrbI, KdsC, Kdo, phosphatase, Hydrolase, Lipopolysaccharide biosynthesis, Magnesium
Deposited on 2009-07-06, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: c3958, kdsC, YrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ba_
  • Chain 'B':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: c3958, kdsC, YrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6bb_
  • Chain 'C':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: c3958, kdsC, YrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6bc_
  • Chain 'D':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: c3958, kdsC, YrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6bd_
  • Heterogens: MG, PO4, KDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6bA (A:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6bA (A:)
    slatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircal
    tsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgdd
    lidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i6bB (B:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6bB (B:)
    aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
    ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
    dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i6bC (C:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6bC (C:)
    aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
    ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
    dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i6bD (D:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6bD (D:)
    aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
    ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
    dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl