PDB entry 3i6a

View 3i6a on RCSB PDB site
Description: Human GST A1-1 GIMF mutant with Glutathione
Class: transferase
Keywords: human GST A1-1, enzyme, Transferase
Deposited on 2009-07-06, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6aa1, d3i6aa2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
      • engineered (221)
    Domains in SCOPe 2.07: d3i6ab1, d3i6ab2
  • Chain 'C':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6ac1, d3i6ac2
  • Chain 'D':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6ad1, d3i6ad2
  • Chain 'E':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6ae1, d3i6ae2
  • Chain 'F':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6af1, d3i6af2
  • Chain 'G':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6ag1, d3i6ag2
  • Chain 'H':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i6ah1, d3i6ah2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6aA (A:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aA (A:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i6aB (B:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aB (B:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i6aC (C:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aC (C:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i6aD (D:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aD (D:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i6aE (E:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aE (E:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i6aF (F:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aF (F:)
    kpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i6aG (G:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aG (G:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i6aH (H:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6aH (H:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif