PDB entry 3i69

View 3i69 on RCSB PDB site
Description: Apo Glutathione Transferase A1-1 GIMF-helix mutant
Class: transferase
Keywords: human GST A1-1, enzyme, Transferase
Deposited on 2009-07-06, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69a1, d3i69a2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
      • engineered (221)
    Domains in SCOPe 2.07: d3i69b1, d3i69b2
  • Chain 'C':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69c1, d3i69c2
  • Chain 'D':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69d1, d3i69d2
  • Chain 'E':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69e1, d3i69e2
  • Chain 'F':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69f1, d3i69f2
  • Chain 'G':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69g1, d3i69g2
  • Chain 'H':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3i69h1, d3i69h2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i69A (A:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69A (A:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i69B (B:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69B (B:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i69C (C:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69C (C:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i69D (D:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69D (D:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i69E (E:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69E (E:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i69F (F:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69F (F:)
    kpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkpppdeiyvrtvyni
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i69G (G:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69G (G:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i69H (H:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i69H (H:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif