PDB entry 3i5z

View 3i5z on RCSB PDB site
Description: Crystal structure of ERK2 bound to (S)-N-(2-hydroxy-1-phenylethyl)-4-(5-methyl-2-(phenylamino)pyrimidin-4-yl)-1H-pyrrole-2-carboxamide
Class: transferase
Keywords: kinase, inhibitor, ATP-binding, Cell cycle, Host-virus interaction, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-07-06, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERK2, MAPK1, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i5za_
  • Heterogens: SO4, Z48, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i5zA (A:)
    mgsshhhhhhssglvprgshmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvc
    saydnvnkvrvaikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkd
    vyivqdlmetdlykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllntt
    cdlkicdfglarvadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilae
    mlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfp
    nadskaldlldkmltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpk
    eklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5zA (A:)
    gagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvvatrwyrapeimlt
    ksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnylls
    lphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsdepiae
    apfkfdmelddlpkeklkelifeetarfqpg