PDB entry 3i5t

View 3i5t on RCSB PDB site
Description: CRYSTAL STRUCTURE OF AMINOTRANSFERASE PRK07036 FROM Rhodobacter sphaeroides KD131
Class: transferase
Keywords: AMINOTRANSFERASE, pyridoxal 5'-phosphate, PSI-2, NYSGXRC, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, Pyridoxal phosphate, Transferase
Deposited on 2009-07-06, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: RHOS4_35670, RSP_3534
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i5ta_
  • Chain 'B':
    Compound: aminotransferase
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: RHOS4_35670, RSP_3534
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i5tb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i5tA (A:)
    mslrndatnaagavgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgp
    agmwcaqvgygrreivdamahqamvlpyaspwymatspaarlaekiatltpgdlnrifft
    tggstavdsalrfsefynnvlgrpqkkriivrydgyhgstaltaactgrtgnwpnfdiaq
    drisflsspnprhagnrsqeaflddlvqefedrieslgpdtiaaflaepilasggviipp
    agyharfkaicekhdilyisdevvtgfgrcgewfasekvfgvvpdiitfakgvtsgyvpl
    gglaiseavlarisgenakgswftngytysnqpvacaaalanielmeregivdqaremad
    yfaaalaslrdlpgvaetrsvglvgcvqclldptradgtaedkaftlkidercfelgliv
    rplgdlcvisppliisraqidemvaimrqaitevsaahgltakepaaveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5tA (A:)
    avgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgpagmwcaqvgygr
    reivdamahqamvlpyaspwymatspaarlaekiatltpgdlnriffttggstavdsalr
    fsefynnvlgrpqkkriivrydgyhgstaltaactgrtgnwpnfdiaqdrisflsspnpr
    hagnrsqeaflddlvqefedrieslgpdtiaaflaepilasggviippagyharfkaice
    khdilyisdevvtgfgrcgewfasekvfgvvpdiitfakgvtsgyvplgglaiseavlar
    isgenakgswftngytysnqpvacaaalanielmeregivdqaremadyfaaalaslrdl
    pgvaetrsvglvgcvqclldgtaedkaftlkidercfelglivrplgdlcvisppliisr
    aqidemvaimrqaitevsaahglt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i5tB (B:)
    mslrndatnaagavgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgp
    agmwcaqvgygrreivdamahqamvlpyaspwymatspaarlaekiatltpgdlnrifft
    tggstavdsalrfsefynnvlgrpqkkriivrydgyhgstaltaactgrtgnwpnfdiaq
    drisflsspnprhagnrsqeaflddlvqefedrieslgpdtiaaflaepilasggviipp
    agyharfkaicekhdilyisdevvtgfgrcgewfasekvfgvvpdiitfakgvtsgyvpl
    gglaiseavlarisgenakgswftngytysnqpvacaaalanielmeregivdqaremad
    yfaaalaslrdlpgvaetrsvglvgcvqclldptradgtaedkaftlkidercfelgliv
    rplgdlcvisppliisraqidemvaimrqaitevsaahgltakepaaveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5tB (B:)
    avgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgpagmwcaqvgygr
    reivdamahqamvlpyaspwymatspaarlaekiatltpgdlnriffttggstavdsalr
    fsefynnvlgrpqkkriivrydgyhgstaltaactgrtgnwpnfdiaqdrisflsspnpr
    hagnrsqeaflddlvqefedrieslgpdtiaaflaepilasggviippagyharfkaice
    khdilyisdevvtgfgrcgewfasekvfgvvpdiitfakgvtsgyvplgglaiseavlar
    isgenakgswftngytysnqpvacaaalanielmeregivdqaremadyfaaalaslrdl
    pgvaetrsvglvgcvqcllgtaedkaftlkidercfelglivrplgdlcvisppliisra
    qidemvaimrqaitevsaahgl