PDB entry 3i5n

View 3i5n on RCSB PDB site
Description: Crystal structure of c-Met with triazolopyridazine inhibitor 13
Class: transferase
Keywords: proto-oncogene, RTK, receptor tyrosine kinase, scatter factor receptor, HGF/SF, Alternative splicing, ATP-binding, Chromosomal rearrangement, Disease mutation, Disulfide bond, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2009-07-06, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • variant (224)
    Domains in SCOPe 2.06: d3i5na_
  • Heterogens: B2D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i5nA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5nA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
    lnrevsqfltegiimkdfshpnvlsllgiclplvvlpymkhgdlrnfirnethnptvkdl
    igfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhklp
    vkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpe
    ycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig