PDB entry 3i4w

View 3i4w on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95
Class: cell adhesion
Keywords: alpha and beta protein, Cell junction, Cell membrane, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Postsynaptic cell membrane, SH3 domain, Synapse, CELL ADHESION
Deposited on 2009-07-03, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered (32)
    Domains in SCOPe 2.07: d3i4wa_
  • Chain 'B':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered (32)
    Domains in SCOPe 2.07: d3i4wb_
  • Chain 'C':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered (32)
    Domains in SCOPe 2.07: d3i4wc_
  • Chain 'D':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered (32)
    Domains in SCOPe 2.07: d3i4wd_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i4wA (A:)
    mglgeedipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4wA (A:)
    edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i4wB (B:)
    mglgeedipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4wB (B:)
    edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i4wC (C:)
    mglgeedipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4wC (C:)
    edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i4wD (D:)
    mglgeedipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqi
    lsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4wD (D:)
    edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea