PDB entry 3i4k

View 3i4k on RCSB PDB site
Description: Crystal structure of Muconate lactonizing enzyme from Corynebacterium glutamicum
Class: isomerase
Keywords: Structural genomics, NYSGXRC, target 9450d, Muconate lactonizing enzyme, Corynebacterium glutamicum, crystal structure, Isomerase, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2009-07-01, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.244
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4ka1, d3i4ka2
  • Chain 'B':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kb1, d3i4kb2
  • Chain 'C':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kc1, d3i4kc2
  • Chain 'D':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kd1, d3i4kd2
  • Chain 'E':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4ke1, d3i4ke2
  • Chain 'F':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kf1, d3i4kf2
  • Chain 'G':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kg1, d3i4kg2
  • Chain 'H':
    Compound: muconate lactonizing enzyme
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: catB, Cgl2401, cg2635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i4kh1, d3i4kh2
  • Heterogens: ACY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i4kA (A:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kA (A:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i4kB (B:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kB (B:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i4kC (C:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kC (C:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i4kD (D:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kD (D:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i4kE (E:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kE (E:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i4kF (F:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kF (F:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i4kG (G:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kG (G:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i4kH (H:)
    mslsdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpw
    wggesvetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawar
    slnvpvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaed
    trrvaelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlrei
    trrtnvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglach
    gatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpgl
    gvdvdmdkvnfytrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4kH (H:)
    dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
    svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
    pvrdllggtvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrv
    aelarevgdrvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrt
    nvsvmadesvwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgats
    legpigtaaslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdv
    dmdkvnfytr