PDB entry 3i4h

View 3i4h on RCSB PDB site
Description: Crystal structure of Cas6 in Pyrococcus furiosus
Class: hydrolase
Keywords: endoribonuclease, HYDROLASE
Deposited on 2009-07-01, released 2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: endoribonuclease
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1S4 (10-End)
      • expression tag (5-9)
    Domains in SCOPe 2.08: d3i4hx1, d3i4hx2, d3i4hx3

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3i4hX (X:)
    mahhhhhhgsrflirlvpedkdrafkvpynhqyylqgliynaikssnpklatylhevkgp
    klftyslfmaekrehpkglpyflgykkgffyfstcvpeiaealvngllmnpevrlwderf
    ylheikvlrepkkfngstfvtlspiavtvvrkgksydvppmekefysiikddlqdkyvma
    ygdkppsefemevliakpkrfrikpgiyqtawhlvfraygnddllkvgyevgfgeknslg
    fgmvkvegnkttkeaeeqekitfnsreelktgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i4hX (X:)
    hhhgsrflirlvpedkdrafkvpynhqyylqgliynaikssnpklatylhevkgpklfty
    slfmaekrehpkglpyflgykkgffyfstcvpeiaealvngllmnpevrlwderfylhei
    kvlrepkkfngstfvtlspiavtvvydvppmekefysiikddlqdkyvmaygdkppsefe
    mevliakpkrfrqtawhlvfraygnddllkvgyevgfgeknslgfgmvkveg