PDB entry 3i3y

View 3i3y on RCSB PDB site
Description: Crystal structure of Ribokinase in Complex with D-Ribose from Klebsiella pneumoniae
Class: transferase
Keywords: Transferase,Kinase,SAD,Ribose,D-ribose metabolic process,ribokinase, PfkB family,11206l1,PSI-II,NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2009-07-01, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.244
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: 5340552, KPN78578_16990, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3i3ya1, d3i3ya2
  • Chain 'B':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: 5340552, KPN78578_16990, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3i3yb1, d3i3yb2
  • Chain 'C':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: 5340552, KPN78578_16990, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3i3yc1, d3i3yc2
  • Chain 'D':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: 5340552, KPN78578_16990, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3i3yd1, d3i3yd2
  • Heterogens: SO4, GOL, RIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i3yA (A:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3yA (A:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldem
    iphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiav
    vneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmla
    sallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i3yB (B:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3yB (B:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiiladgnaiitttaaadtfsldemiph
    madavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavvne
    seaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlasal
    lrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i3yC (C:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3yC (C:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldem
    iphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiav
    vneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmla
    sallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i3yD (D:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3yD (D:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldem
    iphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiav
    vneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmla
    sallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt