PDB entry 3i3x

View 3i3x on RCSB PDB site
Description: Structural Basis for the Sugar Nucleotide and Acyl Chain Selectivity of Leptospira interrogans LpxA
Class: transferase
Keywords: LpxA, Leptospira Interrogans LpxA, L. interrogans LpxA, L. interrogans LpxA product complex, Acyltransferase, Lipid A biosynthesis, Lipid synthesis, Transferase
Deposited on 2009-07-01, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3xa_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3xb_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3xc_
  • Heterogens: U22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i3xA (A:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i3xB (B:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i3xC (C:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr