PDB entry 3i3s

View 3i3s on RCSB PDB site
Description: Crystal Structure of H-Ras with Thr50 replaced by Isoleucine
Class: signaling protein
Keywords: GTPases, H-Ras, Noonan Syndrome, Cell membrane, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, S-nitrosylation, SIGNALING PROTEIN
Deposited on 2009-06-30, released 2009-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.16
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (49)
    Domains in SCOPe 2.01: d3i3sr_
  • Heterogens: GNP, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i3sR (R:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgeiclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh