PDB entry 3i3k

View 3i3k on RCSB PDB site
Description: Crystal structure of human lanosterol 14alpha-demethylase (CYP51) in complex with ketoconazole
Class: Oxidoreductase
Keywords: cytochrome P450, hemeprotein, Alternative splicing, Cholesterol biosynthesis, Endoplasmic reticulum, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Monooxygenase, NADP, Oxidoreductase, Polymorphism, Steroid biosynthesis, Sterol biosynthesis, Transmembrane
Deposited on 2009-06-30, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lanosterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP51, CYP51A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3ka_
  • Chain 'B':
    Compound: Lanosterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP51, CYP51A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3kb_
  • Heterogens: HEM, KLN, BCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i3kA (A:)
    makktlpagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyl
    lgsdaaallfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahf
    kqhvsiieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlya
    dldggfshaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtllda
    tykdgrpltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgen
    lppltydqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvn
    qrlkdswverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlr
    lyefdlidgyfptvnyttmihtpenpvirykrrsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3kA (A:)
    vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i3kB (B:)
    makktlpagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyl
    lgsdaaallfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahf
    kqhvsiieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlya
    dldggfshaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtllda
    tykdgrpltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgen
    lppltydqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvn
    qrlkdswverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlr
    lyefdlidgyfptvnyttmihtpenpvirykrrsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3kB (B:)
    vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrr