PDB entry 3i3i

View 3i3i on RCSB PDB site
Description: Crystal Structure of Bothropstoxin-I crystallized at 283 K
Class: Toxin
Keywords: Homologue Phospholipase A2, Bothropstoxin-I, BthTX-I_10C, Lys49-PLA2 from Bothrops jararacussu, Snake venom, Antibiotic, Antimicrobial, Disulfide bond, Myotoxin, Secreted, Toxin
Deposited on 2009-06-30, released 2010-04-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.158
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog bothropstoxin-1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
  Domains in SCOPe 2.01: d3i3ia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i3iA (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c