PDB entry 3i3c

View 3i3c on RCSB PDB site
Description: Crystal Structural of CBX5 Chromo Shadow Domain
Class: transcription
Keywords: CBX5, Chromo Shadow Domain, Structural Genomics, Structural Genomics Consortium, SGC, Centromere, Nucleus, Phosphoprotein, TRANSCRIPTION
Deposited on 2009-06-30, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3ca_
  • Chain 'B':
    Compound: Chromobox protein homolog 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3cb_
  • Chain 'C':
    Compound: Chromobox protein homolog 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3cc_
  • Chain 'D':
    Compound: Chromobox protein homolog 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX5, HP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i3cd_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i3cA (A:)
    ssgrenlyfqgsndiargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanv
    kcpqiviafyeerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3cA (A:)
    ndiargferglepekiigatddlmflmkwkdtdeadlvlakeanvkcpqiviafyee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i3cB (B:)
    ssgrenlyfqgsndiargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanv
    kcpqiviafyeerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3cB (B:)
    diargferglepekiigatdsdlmflmkwkdtdeadlvlakeanvkcpqiviafyeer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i3cC (C:)
    ssgrenlyfqgsndiargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanv
    kcpqiviafyeerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3cC (C:)
    diargferglepekiigatdgdlmflmkwkdtdeadlvlakeanvkcpqiviafyee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i3cD (D:)
    ssgrenlyfqgsndiargferglepekiigatdscgdlmflmkwkdtdeadlvlakeanv
    kcpqiviafyeerlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i3cD (D:)
    diargferglepekiigatdsdlmflmkwkdtdeadlvlakeanvkcpqiviafyee