PDB entry 3i37

View 3i37 on RCSB PDB site
Description: Proteinase K by LB Nanotemplate Method before high X-Ray dose on ID14-2 Beamline at ESRF
Class: hydrolase
Keywords: Calcium, Disulfide bond, Hydrolase, Metal-binding, Protease, Serine protease, Zymogen
Deposited on 2009-06-30, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.197
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Proteinase K
    Species: Tritirachium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i37x_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i37X (X:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa