PDB entry 3i35

View 3i35 on RCSB PDB site
Description: Human SH3 domain of protein LASP1
Class: transport protein
Keywords: beta-barrel, Structural Genomics, Structural Genomics Consortium, SGC, Actin-binding, Cytoskeleton, Ion transport, LIM domain, Metal-binding, Phosphoprotein, SH3 domain, Transport, TRANSPORT PROTEIN
Deposited on 2009-06-30, released 2009-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LIM and SH3 domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LASP1, MLN50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i35a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3i35A (A:)
gggkryravydysaadedevsfqdgdtivnvqqiddgwmygtvertgdtgmlpanyveai

    Sequence, based on observed residues (ATOM records): (download) 
    >3i35A (A:)
kryravydysaadedevsfqdgdtivnvqqiddgwmygtvertgdtgmlpanyveai