PDB entry 3i2e

View 3i2e on RCSB PDB site
Description: Crystal structure of human dimethylarginine dymethylaminohydrolase-1 (DDAH-1)
Class: hydrolase
Keywords: DDAH, HYDROLASE, NITRIC OXIDE SYNTHASE REGULATOR, Metal-binding, Zinc
Deposited on 2009-06-29, released 2009-08-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDAH, DDAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3i2ea_
  • Chain 'B':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDAH, DDAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3i2eb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i2eA (A:)
    mgsshhhhhhssglvprgshmasmaglghpaafgrathavvralpeslgqhalrsakgee
    vdvaraerqhqlyvgvlgsklglqvvelpadeslpdcvfvedvavvceetalitrpgaps
    rrkevdmmkealeklqlnivemkdenatldggdvlftgreffvglskrtnqrgaeiladt
    fkdyavstvpvadglhlksfcsmagpnliaigssesaqkalkimqqmsdhrydkltvpdd
    iaanciylnipnkghvllhrtpeeypesakvyeklkdhmlipvsmselekvdglltccsv
    linkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i2eA (A:)
    aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
    deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
    ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
    igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
    vyeklkdhmlipvsmselekvdglltccsvlinkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i2eB (B:)
    mgsshhhhhhssglvprgshmasmaglghpaafgrathavvralpeslgqhalrsakgee
    vdvaraerqhqlyvgvlgsklglqvvelpadeslpdcvfvedvavvceetalitrpgaps
    rrkevdmmkealeklqlnivemkdenatldggdvlftgreffvglskrtnqrgaeiladt
    fkdyavstvpvadglhlksfcsmagpnliaigssesaqkalkimqqmsdhrydkltvpdd
    iaanciylnipnkghvllhrtpeeypesakvyeklkdhmlipvsmselekvdglltccsv
    linkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i2eB (B:)
    aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
    deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
    ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
    igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
    vyeklkdhmlipvsmselekvdglltccsvlinkk