PDB entry 3i29

View 3i29 on RCSB PDB site
Description: Crystal structure of a binary complex between an mutant trypsin inhibitor with bovine trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: P1 and P2 MUTANT, TRYPSIN INHIBITOR, BOVINE TRYPSIN, COMPLEX, DIGESTION, HYDROLASE, METAL-BINDING, PROTEASE, SECRETED, SERINE PROTEASE, ZYMOGEN, PROTEASE INHIBITOR, SERINE PROTEASE INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR COMPLEX, Disulfide bond
Deposited on 2009-06-29, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i29a_
  • Chain 'B':
    Compound: Chymotrypsin inhibitor 3
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822 (4-End)
      • engineered mutation (67-68)
    Domains in SCOPe 2.07: d3i29b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i29A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i29B (B:)
    gshmdddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskge
    pirissqyrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilv
    fkfekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkak
    setassh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i29B (B:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqyrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka