PDB entry 3i1y

View 3i1y on RCSB PDB site
Description: Crystal Structure of soluble epoxide Hydrolase
Class: hydrolase
Keywords: hydrolase, Aromatic hydrocarbons catabolism, Cytoplasm, Detoxification, Magnesium, Metal-binding, Peroxisome, Polymorphism
Deposited on 2009-06-28, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i1ya1, d3i1ya2
  • Heterogens: 33N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i1yA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i1yA (A:)
    raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw
    iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt
    ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl
    ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgyvt
    vkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessapp
    eieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntpfi
    panpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhkvc
    eagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslgrk
    ilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikwld
    sdarn