PDB entry 3i1u

View 3i1u on RCSB PDB site
Description: Carboxypeptidase A Inhibited by a Thiirane Mechanism-Based inactivator
Class: hydrolase
Keywords: carboxypeptidase a, hydrolase, thiirane, covalently-modified protein, zinc-dependent protease
Deposited on 2009-06-28, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.148
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1 (Pancreatic)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i1ua_
  • Heterogens: ZN, BTW, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i1uA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i1uA (A:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
    vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
    iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
    htv