PDB entry 3i1h

View 3i1h on RCSB PDB site
Description: Crystal structure of human BFL-1 in complex with BAK BH3 peptide
Deposited on 2009-06-26, released 2009-07-14
The last revision was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein BFL-1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2A1, BCL2L5, BFL1, GRS, HBPA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Apoptosis regulator BAK
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3i1hA (A:)
mghhhhhhshmtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkevek
nlkscldnvnvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiap
dvdtykeisyfvaefimnntgewirqnggwengfvkkfepk

    Sequence, based on observed residues (ATOM records):
    >3i1hA (A:)
cefgyiyrlaqdylqcvlqippsktsrvlqnvafsvqkeveknlkscldnvnvvsvdtar
tlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaefimn
ntgewirqnggwengfvkkfep

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3i1hB (B:)
gqvgrqlaiigddinr