PDB entry 3i18

View 3i18 on RCSB PDB site
Description: crystal structure of the pdz domain of the sdrc-like protein (lmo2051) from listeria monocytogenes, northeast structural genomics consortium target lmr166b
Deposited on 2009-06-25, released 2009-07-14
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmo2051 protein
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: lmo2051
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y5K8 (1-91)
      • see remark 999 (11)
      • expression tag (92)
      • expression tag (97-98)
  • Heterogens: BR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3i18A (A:)
mvkvtydgvyvmsvkddvpaadvlhagdliteidgnafkssqefidyihskkvgdtvkin
ykhgdkneqadikltaidkkgtpgigitlvddlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3i18A (A:)
vkvtydgvyvmsvkddvpaadvlhagdliteidgnafkssqefidyihskkvgdtvkiny
khgdkneqadikltaidkkgtpgigitlvddlhhh