PDB entry 3i0w

View 3i0w on RCSB PDB site
Description: crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing cytosine opposite to 8-oxog
Deposited on 2009-06-25, released 2009-09-29
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.195
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine-DNA-glycosylase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC2707, CA_C2707
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97FM4 (0-289)
      • engineered mutation (221)
  • Chain 'B':
    Compound: 5'-d(*ap*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: EDO, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3i0wA (A:)
    mdfdmieekkdsvivrnvenfelkdifdcgqcfrwhrqengnyigiafekvvevqkiged
    vviynineeefknvwseyfdlyrdygeikkelsrdpllkksvdfgegirilrqdpfeill
    sfiisannripmikkcinnisekagkkleykgkiyyafptvdklheftekdfeectagfr
    akylkdtvdriyngelnleyikslndnecheelkkfmgvgpqvadcimlfsmqkysafpv
    dtwvkkammslyvapdvslkkirdfgrekfgslsgfaqqylfyyarenni
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.