PDB entry 3i05

View 3i05 on RCSB PDB site
Description: Tryptophanyl-tRNA synthetase from Trypanosoma brucei
Class: ligase
Keywords: apo tRNA-ligase, ATP-binding, Aminoacyl-tRNA synthetase, Ligase, Nucleotide-binding, Protein biosynthesis, Structural Genomics, Medical Structural Genomics of Pathogenic Protozoa, MSGPP
Deposited on 2009-06-24, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.3.5580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i05a_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.3.5580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i05b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i05A (A:)
    mahhhhhheavvtpwsvegdvnydklikdfgshaidealleriervlgkkphhflrrgif
    fshrdlnllldvyesgqpfylytgrgpssesmhmghlipfmftkwlqdsfrvplviqmtd
    dekfyfrnipmeqveamttenikdiiamgfdpeltfifrdfdymgcmyrtvakierafta
    sqvrgcfgfamedncgrwmfpaiqaapsfsaafphifppsmgnvfclipqaidqdpyfrl
    trdiaprlgylkpavihskffpglsgpkgkmssssgtavlltdtekmvkdkinkhafsgg
    gatkqehfllganvevdvpiqwlsffleddeelarvkkeymlgrimtgevkkllintita
    itkthqekrklvtdedvqlftstrimgpakkaatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i05A (A:)
    nydklikdfgshaidealleriervlgkkphhflrrgiffshrdlnllldvyesgqpfyl
    ytgrgpssesmhmghlipfmftkwlqdsfrvplviqmtddekfyfrnipmeqveamtten
    ikdiiamgfdpeltfifrdfdymgcmyrtvakieraftasqvrgcfgfamedncgrwmfp
    aiqaapsfsaafphifppsmgnvfclipqaidqdpyfrltrdiaprlgylkpavihskff
    pglavlltdtekmvkdkinvdvpiqwlsffleddeelarvkkmtgevkkllintitaitk
    thqekrklvtdedvqlftstrimgpakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i05B (B:)
    mahhhhhheavvtpwsvegdvnydklikdfgshaidealleriervlgkkphhflrrgif
    fshrdlnllldvyesgqpfylytgrgpssesmhmghlipfmftkwlqdsfrvplviqmtd
    dekfyfrnipmeqveamttenikdiiamgfdpeltfifrdfdymgcmyrtvakierafta
    sqvrgcfgfamedncgrwmfpaiqaapsfsaafphifppsmgnvfclipqaidqdpyfrl
    trdiaprlgylkpavihskffpglsgpkgkmssssgtavlltdtekmvkdkinkhafsgg
    gatkqehfllganvevdvpiqwlsffleddeelarvkkeymlgrimtgevkkllintita
    itkthqekrklvtdedvqlftstrimgpakkaatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i05B (B:)
    nydklikdfgshaidealleriervlgkkphhflrrgiffshrdlnllldvyesgqpfyl
    ytgrgpssesmhmghlipfmftkwlqdsfrvplviqmtddekfyfrnipmeqveamtten
    ikdiiamgfdpeltfifrdfdymgcmyrtvakieraftasqvrgcfgfamedncgrwmfp
    aiqaapsfsaafphifppsmgnvfclipqaidqdpyfrltrdiaprlgylkpavihskff
    pglsavlltdtekmvkdkinkpiqwlsffleddeelarvkkegrimtgevkkllintita
    itkthqekrklvtdedvqlftstrimgpakk