PDB entry 3i03

View 3i03 on RCSB PDB site
Description: Crystal structure of bothropstoxin-I chemically modified by p-bromophenacyl bromide (BPB) - monomeric form at a high resolution
Class: toxin
Keywords: Lys49-PLA2s, Phospholipase homologue, bothropstoxin-I, p-bromophenacyl bromide, myotoxicity, Antibiotic, Antimicrobial, Disulfide bond, Myotoxin, Secreted, Toxin
Deposited on 2009-06-24, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.207
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog bothropstoxin-1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
  Domains in SCOPe 2.07: d3i03a_
• Heterogens: PBP, IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i03A (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c