PDB entry 3i03

View 3i03 on RCSB PDB site
Description: Crystal structure of bothropstoxin-I chemically modified by p-bromophenacyl bromide (BPB) - monomeric form at a high resolution
Class: toxin
Keywords: Lys49-PLA2s, Phospholipase homologue, bothropstoxin-I, p-bromophenacyl bromide, myotoxicity, Antibiotic, Antimicrobial, Disulfide bond, Myotoxin, Secreted, Toxin
Deposited on 2009-06-24, released 2010-05-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.207
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i03a_
  • Heterogens: PBP, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i03A (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c