PDB entry 3hzx

View 3hzx on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease variant D+PHS/V66K at pH 9 determined at 100 K
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdTp, internal waters, Calcium, Endonuclease, Membrane, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2009-06-24, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (43-44)
      • engineered (59)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3hzxa_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzxA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmk
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzxA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmkenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws