PDB entry 3hzq

View 3hzq on RCSB PDB site
Description: structure of a tetrameric mscl in an expanded intermediate state
Deposited on 2009-06-24, released 2009-08-25
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 3.82 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Large-conductance mechanosensitive channel
    Species: Staphylococcus aureus subsp. aureus MW2 [TaxId:196620]
    Gene: mscL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68806 (20-113)
      • expression tag (0-19)
      • engineered mutation (51)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hzqA (A:)
mgsshhhhhhssglvprgshmlkefkefalkgnvldlaiavvmgaafnkiicslveniim
pligkifgsvdfakewsfwgikyglfiqsvidfiiiafalfifvkiantlmkke

    Sequence, based on observed residues (ATOM records):
    >3hzqA (A:)
mlkefkefalkgnvldlaiavvmgaafnkiicslveniimpligkifgsvdfakewsfwg
ikyglfiqsvidfiiiafalfifvkiantlmkke