PDB entry 3hzh

View 3hzh on RCSB PDB site
Description: Crystal structure of the CheX-CheY-BeF3-Mg+2 complex from Borrelia burgdorferi
Class: signaling protein
Keywords: Chemotaxis, Phosphatase, Complex, Response Regulator, Receiver Domain, Two-Component Signal Transduction, SIGNALING PROTEIN
Deposited on 2009-06-23, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.248
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis response regulator (CheY-3)
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0672, CheY3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hzha_
  • Chain 'B':
    Compound: Chemotaxis operon protein (CheX)
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0671, CheX
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hzhA (A:)
mrgshhhhhhgsiqkttiaadssskprginydtgipfnvlivddsvftvkqltqiftseg
fniidtaadgeeavikyknhypnidivtlditmpkmdgitclsnimefdknarvimisal
gkeqlvkdclikgaktfivkpldrakvlqrvmsvfvk

    Sequence, based on observed residues (ATOM records): (download) 
    >3hzhA (A:)
skprginydtgipfnvlivddsvftvkqltqiftsegfniidtaadgeeavikyknhypn
idivtlditmpkmdgitclsnimefdknarvimisalgkeqlvkdclikgaktfivkpld
rakvlqrvmsvfvk

  • Chain 'B':
    No sequence available.