PDB entry 3hzd

View 3hzd on RCSB PDB site
Description: Crystal structure of bothropstoxin-I (BthTX-I), a PLA2 homologue from Bothrops jararacussu venom
Class: toxin
Keywords: Bothrops, snake venom, Phospholipase A2, Lys49-PLA2s, myotoxicity, Antibiotic, Antimicrobial, Disulfide bond, Myotoxin, Secreted, Toxin
Deposited on 2009-06-23, released 2009-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hzda_
  • Chain 'B':
    Compound: Phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hzdb_
  • Heterogens: LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hzdA (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hzdB (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c