PDB entry 3hza

View 3hza on RCSB PDB site
Description: Crystal structure of dUTPase H145W mutant
Class: hydrolase
Keywords: jelly roll, domain swapping, Hydrolase, Nucleotide metabolism
Deposited on 2009-06-23, released 2009-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.117
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dut, Rv2697c, MT2771, MTCY05A6.18c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A552 (20-173)
      • expression tag (12-19)
      • engineered (164)
    Domains in SCOPe 2.06: d3hzaa1, d3hzaa2
  • Heterogens: MG, DUP, GOL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzaA (A:)
    mgsshhhhhhssglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapg
    rralvrtgvavavpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpa
    apivvhrgdriaqllvqrvelvelvevssfdeaglastsrgdggwgssgghasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzaA (A:)
    glvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvava
    vpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdria
    qllvqrvelvelvevssfdeaglastsrgdggwgssgghasl