PDB entry 3hz7

View 3hz7 on RCSB PDB site
Description: crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a
Deposited on 2009-06-23, released 2009-07-07
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Desulfitobacterium hafniense [TaxId:49338]
    Gene: DSY4693
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24NB0 (0-End)
      • see remark 999 (55)
  • Heterogens: SX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hz7A (A:)
mitidalgqvcpipvirakkalaelgeaggvvtvlvdndisrqnlqkmaegmgyqseyle
kdngvievtivagegcavelehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3hz7A (A:)
mitidalgqvcpipvirakkalaelgeaggvvtvlvdndisrqnlqkmaegmgyqseyle
kdngvievtivage