PDB entry 3hyf

View 3hyf on RCSB PDB site
Description: Crystal structure of HIV-1 RNase H p15 with engineered E. coli loop and active site inhibitor
Class: hydrolase
Keywords: RNase H, HIV-1, hydrolase, di-valent metal nucleic acid cleavage mechanism, di-valent metal coordination, Aspartyl protease, DNA integration, DNA recombination, Endonuclease, Multifunctional enzyme, Nuclease, Nucleotidyltransferase, Protease, RNA-directed DNA polymerase, Transferase, Magnesium, Metal-binding
Deposited on 2009-06-22, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Reverse transcriptase/RNaseH
  Species: Escherichia coli [TaxId:83333]
  Gene: pol, Reverse Transcriptase (amino acids 427-560)
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72547 (1-80)
    • initiating methionine (0)
  • Uniprot P0A7Y4 (81-104)
  • Uniprot Q72547 (105-End)
  Domains in SCOPe 2.08: d3hyfa1, d3hyfa2
• Heterogens: MN, ACT, GOL, ON1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3hyfA (A:)
  myqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla
  lqdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekv
  ylawvpahkgiggneqvdklvsagirkvlf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3hyfA (A:)
  myqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla
  lqdsglevnivtdsqyalgiitqwihnwkkrgwpvknvdlvnqiieqlikkekvylawvp
  ahkgiggneqvdklvsagirkvl