PDB entry 3hyb

View 3hyb on RCSB PDB site
Description: Crystal structure of RbcX from Anabaena, crystal form II
Class: chaperone
Keywords: RuBisCO, protein complex assembly, chaperone
Deposited on 2009-06-22, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.247
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RbcX protein
    Species: Anabaena sp. [TaxId:1167]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44212 (20-End)
      • expression tag (10-19)
    Domains in SCOPe 2.07: d3hyba1, d3hyba2
  • Chain 'B':
    Compound: RbcX protein
    Species: Anabaena sp. [TaxId:1167]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44212 (20-End)
      • expression tag (10-19)
    Domains in SCOPe 2.07: d3hybb1, d3hybb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hybA (A:)
    mgsshhhhhhssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalw
    lhnfsagkvqdgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmek
    rrqhlermtqvslshpspeseqqqfsdpdwdnlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hybA (A:)
    ssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvq
    dgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hybB (B:)
    mgsshhhhhhssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalw
    lhnfsagkvqdgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmek
    rrqhlermtqvslshpspeseqqqfsdpdwdnlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hybB (B:)
    ssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvq
    dgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhl