PDB entry 3hy8

View 3hy8 on RCSB PDB site
Description: Crystal Structure of Human Pyridoxine 5'-Phosphate Oxidase R229W Mutant
Class: oxidoreductase
Keywords: FMN binding protein, oxidase, Disease mutation, Epilepsy, Flavoprotein, FMN, Oxidoreductase, Phosphoprotein, Pyridoxal phosphate, Pyridoxine biosynthesis
Deposited on 2009-06-22, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine-5'-phosphate oxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NVS9 (Start-260)
      • engineered (228)
    Domains in SCOPe 2.08: d3hy8a_
  • Heterogens: FMN, PLP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hy8A (A:)
    mtcwlrgvtatfgrpaewpgylshlcgrsaamdlgpmrksyrgdreafeethltsldpvk
    qfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfrfftnfesrkgke
    ldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqigavvshqssvipd
    reylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhdwivfrrglptgd
    splgpmthrgeedwlyerlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hy8A (A:)
    feethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgf
    rfftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqi
    gavvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlh
    dwivfrrglptplgpmthrgeedwlyerlap