PDB entry 3hxd

View 3hxd on RCSB PDB site
Description: Engineered RabGGTase in complex with a peptidomimetic inhibitor (compound 9)
Class: transferase
Keywords: protein prenylation inhibition, TRANSFERASE
Deposited on 2009-06-20, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (Start-237)
      • linker (238-241)
    • Uniprot Q08602 (242-330)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hxdb_
  • Heterogens: ZN, CA, BD7, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hxdB (B:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hxdB (B:)
    qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
    keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
    kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
    eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
    slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
    pvspvfcmpeevlqrvnvqpelvs