PDB entry 3hvt

View 3hvt on RCSB PDB site
Description:
Deposited on 1994-07-25, released 1994-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.266
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3hvta1, d3hvta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3hvtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hvtA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hvtA (A:)
    ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
    aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
    edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviy
    qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtv
    qpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeael
    elaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgah
    tndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpp
    lvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqa
    iylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkg
    iggneqvdklvsagi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hvtB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvkqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hvtB (B:)
    ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
    aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
    edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviy
    qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkepdswtvndiqklvgkln
    wasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdl
    iaeiqkqgqgqwtyqiyqepfknlktgkyahtndvkqlteavqkittesiviwgktpkfk
    lpiqketwetwwteywqatwipewefvntpplvklwyq