PDB entry 3hvp

View 3hvp on RCSB PDB site
Description: conserved folding in retroviral proteases. crystal structure of a synthetic hiv-1 protease
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1989-08-08, released 1989-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unliganded hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.04: d3hvpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hvpA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf