PDB entry 3hvp

View 3hvp on RCSB PDB site
Description: conserved folding in retroviral proteases. crystal structure of a synthetic hiv-1 protease
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1989-08-08, released 1989-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unliganded hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.08: d3hvpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hvpA (A:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf