PDB entry 3hvm

View 3hvm on RCSB PDB site
Description: Agmatine Deiminase from Helicobacter pylori
Class: hydrolase
Keywords: Agmatine Deiminase, HYDROLASE
Deposited on 2009-06-16, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agmatine deiminase
    Species: Helicobacter pylori [TaxId:85963]
    Gene: HPAG1_0045, jhp_0042
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZN18 (0-329)
      • see remark 999 (22)
      • see remark 999 (29)
      • see remark 999 (37)
      • see remark 999 (62)
      • see remark 999 (73-74)
      • see remark 999 (89)
      • see remark 999 (123)
      • see remark 999 (137)
      • see remark 999 (210)
      • see remark 999 (222)
      • see remark 999 (245)
      • see remark 999 (259-261)
      • see remark 999 (279)
      • see remark 999 (290)
      • see remark 999 (292)
      • see remark 999 (299)
    Domains in SCOPe 2.08: d3hvma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hvmA (A:)
    mkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndtig
    yemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqvnf
    klkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlkke
    lgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeelkt
    fkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdaliletlk
    qhtplevigvdcntlikqhgslhcvtmqly